PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.DQ52V
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family HD-ZIP
Protein Properties Length: 296aa    MW: 32522.5 Da    PI: 7.078
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.DQ52VgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox38.12.6e-121681972756
                  HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox  27 aeereeLAkklgLterqVkvWFqNrRakek 56 
                   ++++ LA++l+L  rqV vWFqNrRa+ k
  Aradu.DQ52V 168 WKQKQALAMQLNLRPRQVEVWFQNRRARTK 197
                  5899************************98 PP

2HD-ZIP_I/II895.6e-291692322791
  HD-ZIP_I/II  27 erKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                  ++K++la +L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lk+++++l++en+rL+ke +eL+ +l
  Aradu.DQ52V 169 KQKQALAMQLNLRPRQVEVWFQNRRARTKLKQTEVDCEFLKKCCETLTDENRRLQKELQELK-AL 232
                  79***********************************************************9.54 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003890.0011132203IPR001356Homeobox domain
CDDcd000866.69E-9165200No hitNo description
SuperFamilySSF466891.75E-10166207IPR009057Homeodomain-like
PfamPF000462.0E-9169197IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.2E-10169202IPR009057Homeodomain-like
PROSITE profilePS5007112.163169199IPR001356Homeobox domain
PROSITE patternPS000270174197IPR017970Homeobox, conserved site
SMARTSM003403.5E-25199242IPR003106Leucine zipper, homeobox-associated
PfamPF021835.8E-10199233IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MGLHHDSTHN NNNSGLHLVL GLALSSSSDS PTQETITTST KIPPYSSSST VTTDDAELLL  60
PSLTLALSGH DVNKNKNDDP QEHHRVQVVP TKANNNKVYS SEDYPSTGDV SAQNSPHHSA  120
VSSFSSGCRR GVKRERDVSA SDEAEAEAEA TEIERLSDFI SLILFVCWKQ KQALAMQLNL  180
RPRQVEVWFQ NRRARTKLKQ TEVDCEFLKK CCETLTDENR RLQKELQELK ALKLSQPLYM  240
PPMPAATLTI CPSCDRAVAI GSGGSASNNI KNTPLISLAP KPHHFFSPFT NPSAAC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1191199RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015957834.10.0PREDICTED: homeobox-leucine zipper protein HAT22-like
TrEMBLA0A151TJB61e-82A0A151TJB6_CAJCA; Homeobox-leucine zipper protein HAT22
STRINGGLYMA11G04840.15e-79(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF114433107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.12e-48HD-ZIP family protein